Structure of PDB 4hze Chain A

Receptor sequence

>4hzeA (length=306) Species: 9606 (Homo sapiens)

HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSF
TPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLA
IGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQD
KVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDID
RLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTY
REGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSF
GQTREG

3D structure

• PDB: 4hze Discovery of (R)-2-Amino-6-borono-2-(2-(piperidin-1-yl)ethyl)hexanoic Acid and Congeners As Highly Potent Inhibitors of Human Arginases I and II for Treatment of Myocardial Reperfusion Injury.
• Chain: A
• Resolution: 1.602 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H120 D143 H145 D147 H160 D251 D253 E296
• Catalytic site (residue number reindexed from 1): H97 D120 H122 D124 H137 D228 D230 E273
• Enzyme Commision number: 3.5.3.1: arginase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H120 D143 D147 D251	H97 D120 D124 D228
BS02	MN	A	D143 H145 D251 D253	D120 H122 D228 D230
BS03	X7A	A	H120 D143 H145 D147 S156 H160 D202 D251	H97 D120 H122 D124 S133 H137 D179 D228	MOAD: ic50=509nM PDBbind-CN: -logKd/Ki=6.29,IC50=509nM

Gene Ontology

Molecular Function

• GO:0004053 arginase activity
• GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
• GO:0046872 metal ion binding

Biological Process

• GO:0006525 arginine metabolic process

External links

• PDB: RCSB:4hze, PDBe:4hze, PDBj:4hze
• PDBsum: 4hze
• PubMed: 23472952
• UniProt: P78540|ARGI2_HUMAN Arginase-2, mitochondrial (Gene Name=ARG2)