Structure of PDB 4hu7 Chain A |
>4hu7A (length=107) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQ GKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGALSKGQLK EFLDANL |
|
PDB | 4hu7 (4R)- and (4S)-Fluoroproline in the Conserved cis-Prolyl Peptide Bond of the Thioredoxin Fold: Tertiary Structure Context Dictates Ring Puckering. |
Chain | A |
Resolution | 1.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
S1 D2 |
S1 D2 |
|
|
|
|