Structure of PDB 4ht8 Chain A

Receptor sequence

>4ht8A (length=61) Species: 469008 (Escherichia coli BL21(DE3))

QSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPS

3D structure

• PDB: 4ht8 Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	Y25 L26 G29 I30 K31 L32 Q33 Q52 S60 T61	Y21 L22 G25 I26 K27 L28 Q29 Q48 S56 T57	PDBbind-CN: Kd=113nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 24 10:56:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ht8', asym_id = 'A', title = 'Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ht8', asym_id='A', title='Hfq-bridged ternary complex is important for translation activation of rpoS by DsrA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0006355', uniprot = '', pdbid = '4ht8', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0006355', uniprot='', pdbid='4ht8', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>