Structure of PDB 4hjv Chain A

Receptor sequence
>4hjvA (length=184) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
HDYTNPPWNAKVPVQRAMQWMPISQKAGAAWGVDPQLITAIIAIESGGNP
NAVSKSNAIGLMQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAA
YLNILETGPLAGIEDPKVLQYALVVSYANGAGALLRTFSSDRKKAISKIN
DLDADEFLEHVARNHPAPQAPRYIYKLEQALDAM
3D structure
PDB4hjv On the Mechanism of Peptidoglycan Binding and Cleavage by the endo-Specific Lytic Transglycosylase MltE from Escherichia coli.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 4.2.2.n2: peptidoglycan lytic endotransglycosylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AMU A W27 E64 R191 K195 W8 E45 R172 K176
BS02 BLG A E64 S73 K74 S75 A77 Q82 L83 K84 T87 S88 Y120 Y146 A147 G149 E45 S54 K55 S56 A58 Q63 L64 K65 T68 S69 Y101 Y127 A128 G130
Gene Ontology
Molecular Function
GO:0008932 lytic endotransglycosylase activity
GO:0008933 lytic transglycosylase activity
GO:0016829 lyase activity
GO:0016837 carbon-oxygen lyase activity, acting on polysaccharides
Biological Process
GO:0000270 peptidoglycan metabolic process
GO:0016998 cell wall macromolecule catabolic process
GO:0051301 cell division
GO:0071555 cell wall organization
Cellular Component
GO:0009279 cell outer membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hjv, PDBe:4hjv, PDBj:4hjv
PDBsum4hjv
PubMed23075328
UniProtP0C960|EMTA_ECOLI Endo-type membrane-bound lytic murein transglycosylase A (Gene Name=emtA)

[Back to BioLiP]