Structure of PDB 4hhv Chain A |
>4hhvA (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] |
FSGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGS ICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTE SGY |
|
PDB | 4hhv Crystal Structure of the Pleckstrin Homology Domain from the Ceramide Transfer Protein: Implications for Conformational Change upon Ligand Binding. |
Chain | A |
Resolution | 1.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SO4 |
A |
K32 R43 Y54 K56 |
K14 R25 Y36 K38 |
|
|
|