Structure of PDB 4hcf Chain A |
>4hcfA (length=88) Species: 198094 (Bacillus anthracis str. Ames) [Search protein sequence] |
AKVIEVELNDDYFNPNVITIPINESTTLLLKNKGKSEHTFTIKKLGIDVV VESGKEKNITVKPKSAGTYELICRYHLLKGMEGKVIVK |
|
PDB | 4hcf Crystal Structure of Uncharacterized Cupredoxin-like Domain Protein Cupredoxin_1 with Copper Bound from Bacillus anthracis |
Chain | A |
Resolution | 1.703 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H78 C113 H116 M121 |
H38 C73 H76 M81 |
|
|
|