Structure of PDB 4hca Chain A

Receptor sequence
>4hcaA (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
MGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPTSCAN
CQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKM
3D structure
PDB4hca DNA Binding by GATA Transcription Factor Suggests Mechanisms of DNA Looping and Long-Range Gene Regulation.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A N286 A287 R299 R330 R331 K347 R365 N366 R367 N27 A28 R40 R60 R61 K77 R95 N96 R97
BS02 dna A R276 R277 Y283 N340 L344 R353 M357 K359 T364 R365 R367 R17 R18 Y24 N70 L74 R83 M87 K89 T94 R95 R97
BS03 ZN A C267 C288 C8 C29
BS04 ZN A C318 C321 C339 C342 C48 C51 C69 C72
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hca, PDBe:4hca, PDBj:4hca
PDBsum4hca
PubMed23142663
UniProtP23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=GATA3)

[Back to BioLiP]