Structure of PDB 4hc9 Chain A

Receptor sequence
>4hc9A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence]
RECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAA
RRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG
IQTRN
3D structure
PDB4hc9 DNA Binding by GATA Transcription Factor Suggests Mechanisms of DNA Looping and Long-Range Gene Regulation.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A P273 N286 L290 R299 P12 N25 L29 R38
BS02 dna A R262 L274 R276 R277 R1 L13 R15 R16
BS03 ZN A C318 C321 C339 C342 C57 C60 C78 C81
BS04 ZN A C264 C267 C285 C288 C3 C6 C24 C27
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4hc9, PDBe:4hc9, PDBj:4hc9
PDBsum4hc9
PubMed23142663
UniProtP23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 (Gene Name=GATA3)

[Back to BioLiP]