Structure of PDB 4hb6 Chain A

Receptor sequence

>4hb6A (length=71) Species: 35554 (Geobacter sulfurreducens) [Search protein sequence]

ADDIVLKAKNGDVKFPHKAHQEAVPDCKKCHEKGPGKIEGFGKEMAHGKG
CKGCHEEMKKGPTKCGECHKK

3D structure

PDB

4hb6 Lysine mutants of PpcA

Chain

Resolution

1.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	A1 D2 F15 H17 Q21 V24 C27 C30 H31	A1 D2 F15 H17 Q21 V24 C27 C30 H31
BS02	HEC	A	F15 P16 H20 A23 G50 C51 C54 H55 M58 K60 P62	F15 P16 H20 A23 G50 C51 C54 H55 M58 K60 P62
BS03	HEC	A	L6 A8 K9 N10 F41 G42 K43 A46 H47 C51 K52 T63 K64 C65 C68 H69	L6 A8 K9 N10 F41 G42 K43 A46 H47 C51 K52 T63 K64 C65 C68 H69
BS04	DXC	A	K37 F41 M45 G50	K37 F41 M45 G50

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding

External links