Structure of PDB 4h3x Chain A

Receptor sequence
>4h3xA (length=164) Species: 9606 (Homo sapiens) [Search protein sequence]
GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLT
FTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFD
DDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPP
LHKDDVNGIRHLYG
3D structure
PDB4h3x Crystallization of bi-functional ligand protein complexes.
ChainA
Resolution1.764 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H226 E227 H230 H236
Catalytic site (residue number reindexed from 1) H121 E122 H125 H131
Enzyme Commision number 3.4.24.35: gelatinase B.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H226 H230 H236 H121 H125 H131
BS02 ZN A H175 D177 H190 H203 H70 D72 H85 H98
BS03 CA A D182 G183 D185 L187 D205 E208 D77 G78 D80 L82 D100 E103
BS04 CA A D131 D206 E208 D26 D101 E103
BS05 CA A D165 G197 Q199 D201 D60 G92 Q94 D96
BS06 10B A L187 L188 A189 L222 H226 E227 H230 H236 L243 Y245 M247 L82 L83 A84 L117 H121 E122 H125 H131 L138 Y140 M142 BindingDB: IC50=200nM
BS07 10B A Y245 P246 Y140 P141 BindingDB: IC50=200nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h3x, PDBe:4h3x, PDBj:4h3x
PDBsum4h3x
PubMed23567804
UniProtP14780|MMP9_HUMAN Matrix metalloproteinase-9 (Gene Name=MMP9)

[Back to BioLiP]