Structure of PDB 4h31 Chain A

Receptor sequence

>4h31A (length=335) Species: 216895 (Vibrio vulnificus CMCP6)

NAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKN
IALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVL
GRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLE
HSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEE
LVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDER
VALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKG
LEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLG

3D structure

• PDB: 4h31 Structural studies of ornithine carbamoyltransferase from various pathogens
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R59 T60 D87 R108 H135 Q138 D233 C275 R320
• Catalytic site (residue number reindexed from 1): R61 T62 D89 R110 H137 Q140 D235 C277 R322
• Enzyme Commision number: 2.1.3.3: ornithine carbamoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NVA	A	L130 N169 D233 S237 M238	L132 N171 D235 S239 M240
BS02	CP	A	S57 T58 R59 T60 R108 H135 Q138 C275 L276 R320	S59 T60 R61 T62 R110 H137 Q140 C277 L278 R322

Gene Ontology

Molecular Function

• GO:0004585 ornithine carbamoyltransferase activity
• GO:0016597 amino acid binding
• GO:0016740 transferase activity
• GO:0016743 carboxyl- or carbamoyltransferase activity

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0006526 L-arginine biosynthetic process
• GO:0006591 ornithine metabolic process
• GO:0019240 citrulline biosynthetic process
• GO:0042450 arginine biosynthetic process via ornithine

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4h31, PDBe:4h31, PDBj:4h31
• PDBsum: 4h31
• UniProt: Q8DCF5|OTC_VIBVU Ornithine carbamoyltransferase (Gene Name=argF)