Structure of PDB 4h10 Chain A

Receptor sequence
>4h10A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence]
RIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMA
VQHMKTLRGA
3D structure
PDB4h10 Intermolecular recognition revealed by the complex structure of human CLOCK-BMAL1 basic helix-loop-helix domains with E-box DNA.
ChainA
Resolution2.402 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A H77 S78 E81 R85 D110 K111 H9 S10 E13 R17 D42 K43 PDBbind-CN: Kd=1.52uM
BS02 dna A I80 E81 R84 I12 E13 R16 PDBbind-CN: Kd=1.52uM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h10, PDBe:4h10, PDBj:4h10
PDBsum4h10
PubMed23229515
UniProtO00327|BMAL1_HUMAN Basic helix-loop-helix ARNT-like protein 1 (Gene Name=BMAL1)

[Back to BioLiP]