Structure of PDB 4h0l Chain A

Receptor sequence

>4h0lA (length=213) Species: 83541 (Mastigocladus laminosus)

NVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGF
AMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVF
RVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVS
GVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLLH
FLMIRKQGISGPL

3D structure

• PDB: 4h0l Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
• Chain: A
• Resolution: 3.25 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R207 I211
• Catalytic site (residue number reindexed from 1): R205 I209

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	N31 I32	N29 I30
BS02	HEM	A	F44 Q47 G51 F52 M54 T55 Y58 R83 H86 R87 A90 M93 F131 G135 L138 P139 H187 T188	F42 Q45 G49 F50 M52 T53 Y56 R81 H84 R85 A88 M91 F129 G133 L136 P137 H185 T186
BS03	HEM	A	Y34 G37 T40 M97 H100 R103 V104 G109 T117 W118 G121 V122 H202 I206 I211 S212	Y32 G35 T38 M95 H98 R101 V102 G107 T115 W116 G119 V120 H200 I204 I209 S210
BS04	HEM	A	V30 Y34 C35 G38 L41 F203 R207 G210 I211	V28 Y32 C33 G36 L39 F201 R205 G208 I209
BS05	QNO	A	K24 R207	K22 R205

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4h0l, PDBe:4h0l, PDBj:4h0l
• PDBsum: 4h0l
• PubMed: 23440205
• UniProt: P83791|CYB6_MASLA Cytochrome b6 (Gene Name=petB)