Structure of PDB 4gww Chain A

Receptor sequence
>4gwwA (length=314) Species: 9823 (Sus scrofa) [Search protein sequence]
TNIVTLTRFVKEEGRKARGTGEMTQLLNSLCTAVKAISTAVRKAGIAHVK
KLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEPEKRGKYVVCFDPLD
GSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGRNLVAAGYALYGSAT
MLVLAMVNGVNCFMLDPAIGEFILVDRDVKIKKKGSIYSINEGYAKEFDP
AITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFMYPANKKSP
KGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIVPTDIHQRAPIILGSP
EDVTELLEIYQKHA
3D structure
PDB4gww Functional Importance of Subunit Pair Rotation in Regulation of Tetrameric Mammalian Fructose-1,6-bisphosphatase
ChainA
Resolution3.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D74 E97 E98 D118 L120 D121 E280
Catalytic site (residue number reindexed from 1) D53 E76 E77 D97 L99 D100 E259
Enzyme Commision number 3.1.3.11: fructose-bisphosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 F6P A G26 T27 G28 E29 M30 K112 Y113 V160 M177 G19 T20 G21 E22 M23 K91 Y92 V139 M156
BS02 F6P A D121 N212 Y215 Y244 G246 S247 M248 Y264 K274 D100 N191 Y194 Y223 G225 S226 M227 Y243 K253
BS03 MG A D118 L120 D97 L99
BS04 MG A E97 D118 D121 E280 E76 D97 D100 E259
Gene Ontology
Molecular Function
GO:0016208 AMP binding
GO:0016787 hydrolase activity
GO:0016791 phosphatase activity
GO:0042132 fructose 1,6-bisphosphate 1-phosphatase activity
GO:0042578 phosphoric ester hydrolase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0048029 monosaccharide binding
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0005986 sucrose biosynthetic process
GO:0006000 fructose metabolic process
GO:0006002 fructose 6-phosphate metabolic process
GO:0006094 gluconeogenesis
GO:0006111 regulation of gluconeogenesis
GO:0016311 dephosphorylation
GO:0030308 negative regulation of cell growth
GO:0030388 fructose 1,6-bisphosphate metabolic process
GO:0045820 negative regulation of glycolytic process
GO:0046580 negative regulation of Ras protein signal transduction
GO:0071286 cellular response to magnesium ion
GO:0071466 cellular response to xenobiotic stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gww, PDBe:4gww, PDBj:4gww
PDBsum4gww
PubMed
UniProtP00636|F16P1_PIG Fructose-1,6-bisphosphatase 1 (Gene Name=FBP1)

[Back to BioLiP]