Structure of PDB 4gp5 Chain A

Receptor sequence

>4gp5A (length=552) Species: 300852 (Thermus thermophilus HB8)

SRVYEAYPEKKATLYFLVLGFLALIVGSLFGPFQALNYGNVDAYPLLKRL
LPFVQSYYQGLTLHGVLNAIVFTQLFAQAIMVYLPARELNMRPNMGLMWL
SWWMAFIGLVVAALPLLANEATVLWTFYPPLKGHWAFYLGASVFVLSTWV
SIYIVLDLWRRWKAANPGKVTPLVTYMAVVFWLMWFLASLGLVLEAVLFL
LPWSFGLVEGVDPLVARTLFWWTGHPIVYFWLLPAYAIIYTILPKQAGGK
LVSDPMARLAFLLFLLLSTPVGFHHQFADPGIDPTWKMIHSVLTLFVAVP
SLMTAFTVAASLEFAGRLRGGRGLFGWIRALPWDNPAFVAPVLGLLGFIP
GGAGGIVNASFTLDYVVHNTAWVPGHFHLQVASLVTLTAMGSLYWLLPNL
TGKPISDAQRRLGLAVVWLWFLGMMIMAVGLHWAGLLNVPRRAYIAQVPD
AYPHAAVPMVFNVLAGIVLLVALLLFIYGLFSVLLSRERKPELAEAPLPF
AEVIPEDRRLVLAMDRIGFWFAVAAILVVLAYGPTLVQLFGHLNPVPGWR
LW

3D structure

• PDB: 4gp5 Ligand Access to the Active Site in Thermus thermophilusba(3) and Bovine Heart aa(3) Cytochrome Oxidases.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H72 P101 W133 S155 T156 H233 I235 Y237 Y248 H282 H283 S309 G331 H384 F385 H386 R449 R450
• Catalytic site (residue number reindexed from 1): H64 P93 W125 S147 T148 H225 I227 Y229 Y240 H274 H275 S301 G323 H376 F377 H378 R441 R442
• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	A	H233 H282 H283	H225 H274 H275
BS02	HEM	A	G39 Q42 A43 Y46 Y65 L69 H72 N76 F385 H386 V389 A390 T394 W428 M432 M435 R449 R450	G31 Q34 A35 Y38 Y57 L61 H64 N68 F377 H378 V381 A382 T386 W420 M424 M427 R441 R442
BS03	HAS	A	W133 W229 V236 Y237 H282 H283 S309 A313 L353 F356 G360 G363 N366 A367 D372 H376 V381 H384 F385 Q388 V389 R449	W125 W221 V228 Y229 H274 H275 S301 A305 L345 F348 G352 G355 N358 A359 D364 H368 V373 H376 F377 Q380 V381 R441

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0009060 aerobic respiration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:4gp5, PDBe:4gp5, PDBj:4gp5
• PDBsum: 4gp5
• PubMed: 23282175
• UniProt: Q5SJ79|COX1_THET8 Cytochrome c oxidase subunit 1 (Gene Name=cbaA)