Structure of PDB 4gok Chain A

Receptor sequence
>4gokA (length=158) Species: 10090 (Mus musculus) [Search protein sequence]
LRLLMLGLDNAGKTTILKKFNTISPTLGFNIKTLEHRGFKLNIWDVGGLK
SLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLL
IFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDW
LLDDISSR
3D structure
PDB4gok Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
ChainA
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) L70
Catalytic site (residue number reindexed from 1) L49
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP A D25 N26 G28 K29 T30 T31 T47 G69 N125 K126 D128 L129 S158 A159 V160 D9 N10 G12 K13 T14 T15 T26 G48 N104 K105 D107 L108 S137 A138 V139
BS02 MG A T30 T47 D66 T14 T26 D45
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
Biological Process
GO:0006110 regulation of glycolytic process
GO:0007098 centrosome cycle
GO:0010811 positive regulation of cell-substrate adhesion
GO:0031113 regulation of microtubule polymerization
GO:0031116 positive regulation of microtubule polymerization
GO:0034260 negative regulation of GTPase activity
GO:0051457 maintenance of protein location in nucleus
GO:0070830 bicellular tight junction assembly
GO:1903715 regulation of aerobic respiration
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005925 focal adhesion
GO:0016328 lateral plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gok, PDBe:4gok, PDBj:4gok
PDBsum4gok
PubMed22960633
UniProtQ9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 (Gene Name=Arl2)

[Back to BioLiP]