Structure of PDB 4gne Chain A

Receptor sequence

>4gneA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]

PKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWH
QCDECSSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAP

3D structure

PDB

4gne The methyltransferase NSD3 has chromatin-binding motifs, PHD5-C5HCH, that are distinct from other NSD (nuclear receptor SET domain) family members in their histone H3 recognition.

Chain

Resolution

1.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.1.1.370: [histone H3]-lysine(4) N-dimethyltransferase.
2.1.1.371: [histone H3]-lysine(27) N-dimethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	E1321 D1322 G1330 G1331 E1332 L1333 V1334 M1335 P1356 G1358	E6 D7 G15 G16 E17 L18 V19 M20 P41 G43
BS02	ZN	A	C1324 C1327 H1346 C1349	C9 C12 H31 C34
BS03	ZN	A	C1336 C1341 C1362 H1365	C21 C26 C47 H50
BS04	ZN	A	C1378 C1381 C1405 H1408	C63 C66 C90 H93
BS05	ZN	A	C1367 C1370 C1386 H1389	C52 C55 C71 H74

External links

PDB	RCSB:4gne, PDBe:4gne, PDBj:4gne
PDBsum	4gne
PubMed	23269674
UniProt	Q9BZ95\|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 (Gene Name=NSD3)

[Back to BioLiP]