Structure of PDB 4glj Chain A

Receptor sequence

>4gljA (length=287) Species: 77133 (uncultured bacterium)

KNAADIAIIGGSGLYQMQALTNKRSVKIETPYGEPSDDIVLGELNGVTVA
FLTRHGQGHRLTPSEVPYRANIYALKTLGVRYIVSVSAVGSLQETLKPLD
MVIPDQMIDMTKQRVSTFFGDGAVAHVSMADPLCPEVADILIRAYDNADI
ADGQCHAKATYVCIEGPQFSTRAESHWYRQMQADIIGMTNMPEAKLAREA
SIAYATLALVTDFDCWHPNEQAVSADYAIQNLMKNADNAQQVIKQAVALI
ASEQPKSIAHTALTQALVTPVEAMSAETKTRLAALLP

3D structure

• PDB: 4glj A study on the interaction of rhodamine B with methylthioadenosine phosphorylase protein sourced from an antarctic soil metagenomic library.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D222 D224
• Catalytic site (residue number reindexed from 1): D212 D214
• Enzyme Commision number: 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RHB	A	S22 Y25 H65 F179 I239 L242	S12 Y15 H55 F169 I229 L232
BS02	RHB	A	A98 G100 F179 I196 G197 M198 D222 F223 D224 N229 A238	A88 G90 F169 I186 G187 M188 D212 F213 D214 N219 A228

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0017061 S-methyl-5-thioadenosine phosphorylase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0009116 nucleoside metabolic process
• GO:0019509 L-methionine salvage from methylthioadenosine

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4glj, PDBe:4glj, PDBj:4glj
• PDBsum: 4glj
• PubMed: 23383268
• UniProt: C6KFA4