Structure of PDB 4gld Chain A

Receptor sequence

>4gldA (length=121) Species: 97228 (Daboia russelii pulchella)

SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCC
YGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNL
NTYSKKYMLYPDFLCKGELKC

3D structure

• PDB: 4gld Crystal Structure of the complex of type II phospholipase A2 with a designed peptide inhibitor Phe - Leu - Ala - Tyr - Lys at 1.69 A resolution
• Chain: A
• Resolution: 1.69 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y28 G30 G32 H48 D49 Y52 Y73 D99
• Catalytic site (residue number reindexed from 1): Y27 G29 G31 H47 D48 Y51 Y64 D89
• Enzyme Commision number: 3.1.1.4: phospholipase A2.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	L2 L3 F5 G6 K7 L17 A18 I19 Y22 S23 G30 C45 H48	L2 L3 F5 G6 K7 L16 A17 I18 Y21 S22 G29 C44 H47

Gene Ontology

Molecular Function

• GO:0004623 phospholipase A2 activity
• GO:0005509 calcium ion binding
• GO:0005543 phospholipid binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding
• GO:0047498 calcium-dependent phospholipase A2 activity
• GO:0090729 toxin activity

Biological Process

• GO:0006644 phospholipid metabolic process
• GO:0016042 lipid catabolic process
• GO:0035821 modulation of process of another organism
• GO:0042130 negative regulation of T cell proliferation
• GO:0050482 arachidonate secretion

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4gld, PDBe:4gld, PDBj:4gld
• PDBsum: 4gld
• UniProt: P59071|PA2B8_DABRR Basic phospholipase A2 VRV-PL-VIIIa