Structure of PDB 4gje Chain A |
>4gjeA (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] |
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQ NPTPEELQEMIDEVDEGTVDFDEFLVMMVRCMKDDS |
|
PDB | 4gje The structure of cardiac troponin C regulatory domain with bound Cd(2+) reveals a closed conformation and unique ion coordination. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E15 E19 |
E15 E19 |
|
|
|
|