Structure of PDB 4gd3 Chain A

Receptor sequence
>4gd3A (length=179) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
VVSHYVFEAPVRIWHWLTVLCMAVLMVTGYFIGKPLPSVSGEATYLFYMG
YIRLIHFSAGMVFTVVLLMRIYWAFVGNRYSRQGVWYEIRWYLFLPIAQA
AMFGYFLMSVFMIITGFALYSEHSQYAIFAPFRYVVEFFYWTGGNSMDIH
SWHRLGMWLIGAFVIGHVYMALREDIMSD
3D structure
PDB4gd3 Crystal Structure of the O(2)-Tolerant Membrane-Bound Hydrogenase 1 from Escherichia coli in Complex with Its Cognate Cytochrome b.
ChainA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A L32 M33 G36 I39 G40 R60 H63 F64 M143 G147 F148 Y151 H181 H184 R185 M188 L25 M26 G29 I32 G33 R53 H56 F57 M112 G116 F117 Y120 H150 H153 R154 M157
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0033748 hydrogenase (acceptor) activity
GO:0046872 metal ion binding
Biological Process
GO:0006113 fermentation
GO:0009061 anaerobic respiration
GO:0009267 cellular response to starvation
GO:0019645 anaerobic electron transport chain
GO:0022904 respiratory electron transport chain
GO:1902421 hydrogen metabolic process
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0044569 [Ni-Fe] hydrogenase complex
GO:0098567 periplasmic side of plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gd3, PDBe:4gd3, PDBj:4gd3
PDBsum4gd3
PubMed23260654
UniProtP0AAM1|CYBH_ECOLI Probable Ni/Fe-hydrogenase 1 B-type cytochrome subunit (Gene Name=hyaC)

[Back to BioLiP]