Structure of PDB 4gct Chain A

Receptor sequence
>4gctA (length=185) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961) [Search protein sequence]
INRREEILQALAEMLESNEGASRITTAKLAKQVGVSEAALYRHFPSKTRM
FEGLIEFIEESLMSRINRIFDEEKDTLNRIRLVMQLLLAFAERNPGLTRI
LSGHALMFENERLRDRINQLFERIETSLRQILRERKSFPVDENILAAQLL
GQVEGSLNRFVRSDFKYLPTANFDEYWALLSAQIK
3D structure
PDB4gct SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.
ChainA
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R9 V41 S42 A44 A45 R48 R3 V35 S36 A38 A39 R42 PDBbind-CN: Kd=53.4nM
BS02 dna A R29 T31 T32 E43 Y47 S52 K53 R23 T25 T26 E37 Y41 S46 K47 PDBbind-CN: Kd=53.4nM
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010974 negative regulation of division septum assembly
GO:0051301 cell division
GO:0051302 regulation of cell division
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid
GO:0043590 bacterial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gct, PDBe:4gct, PDBj:4gct
PDBsum4gct
PubMed23754405
UniProtQ9KVD2|SLMA_VIBCH Nucleoid occlusion factor SlmA (Gene Name=slmA)

[Back to BioLiP]