Structure of PDB 4gb2 Chain A |
>4gb2A (length=99) Species: 11686 (Human immunodeficiency virus type 1 (BRU ISOLATE)) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGI GGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 4gb2 Cocrystallization of potent pyrrolidine based HIV-1 protease inhibitors |
Chain | A |
Resolution | 1.788 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
0LQ |
A |
D25 G27 V82 |
D25 G27 V82 |
|
|
|
|