Structure of PDB 4g89 Chain A

Receptor sequence

>4g89A (length=233) Species: 272620 (Klebsiella pneumoniae subsp. pneumoniae MGH 78578)

SMKIGIIGAMEEEVTLLRDKIENRQTITIGGSEIYTGQLHGVDVALLKSG
IGKVAAAMGATLLLERCQPDVIINTGSAGGLASTLKVGDIVVSDEARYHD
ADVTAFGYEYGQLPGCPAGFKADEKLVAAAESCIKALDLNAVRGLIVSGD
AFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVA
DQQSHLSFEEFLAVAARQSTLMVENLVQNLARG

3D structure

• PDB: 4g89 Crystal structure of k. pneumoniae mta/adohcy nucleosidase in complex with fragmented s-adenosyl-l-homocysteine
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 3.2.2.9: adenosylhomocysteine nucleosidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADE	A	A77 G78 F151 I152 E172 D197 A199 F207	A78 G79 F152 I153 E173 D198 A200 F208
BS02	SAH	A	M9 I50 S76 F151 M173 E174 R193 F207	M10 I51 S77 F152 M174 E175 R194 F208

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008782 adenosylhomocysteine nucleosidase activity
• GO:0008930 methylthioadenosine nucleosidase activity
• GO:0016787 hydrolase activity

Biological Process

• GO:0009086 methionine biosynthetic process
• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0019284 L-methionine salvage from S-adenosylmethionine
• GO:0019509 L-methionine salvage from methylthioadenosine
• GO:0046124 purine deoxyribonucleoside catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4g89, PDBe:4g89, PDBj:4g89
• PDBsum: 4g89
• UniProt: A6T4W3|MTNN_KLEP7 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (Gene Name=mtnN)