Structure of PDB 4g73 Chain A

Receptor sequence

>4g73A (length=472) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

TMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFT
PLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTI
KSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDY
GHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGV
EAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQS
HLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGN
KARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPP
TAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKY
NDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARS
RLKVFFDWIKLAFFKRDFFKGL

3D structure

PDB

4g73 Structural insight into the type-II mitochondrial NADH dehydrogenases.

Chain

Resolution

2.522 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MG	A	Q49 K53 N55	Q8 K12 N14
BS02	UQ5	A	W63 A393 Q394 H397 L444 L447 I459 M485	W22 A352 Q353 H356 L403 L406 I418 M444
BS03	FAD	A	G60 S61 G62 W63 G64 S83 P84 R85 T91 P92 P95 A129 A175 V176 G177 T239 R344 G382 D383 P391 T392 A393	G19 S20 G21 W22 G23 S42 P43 R44 T50 P51 P54 A88 A134 V135 G136 T198 R303 G341 D342 P350 T351 A352
BS04	MG	A	A175 G177 I381 G382 D383 N384	A134 G136 I340 G341 D342 N343
BS05	MG	A	G62 G64 A65 A175	G21 G23 A24 A134
BS06	MG	A	G62 W63 R85 L89	G21 W22 R44 L48
BS07	MG	A	G177 A178 K196	G136 A137 K155
BS08	NAI	A	G235 P238 T239 E272 A273 A305 V306 T339 L447 Y482	G194 P197 T198 E231 A232 A264 V265 T298 L406 Y441

Gene Ontology

	Molecular Function
GO:0003954	NADH dehydrogenase activity
GO:0008137	NADH dehydrogenase (ubiquinone) activity
GO:0016491	oxidoreductase activity
GO:0042802	identical protein binding
GO:0050136	NADH:ubiquinone reductase (non-electrogenic) activity

	Biological Process
GO:0006116	NADH oxidation
GO:0006120	mitochondrial electron transport, NADH to ubiquinone
GO:0043065	positive regulation of apoptotic process
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4g73, PDBe:4g73, PDBj:4g73
PDBsum	4g73
PubMed	23086143
UniProt	P32340\|NDI1_YEAST Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial (Gene Name=NDI1)

[Back to BioLiP]