Structure of PDB 4g5q Chain A

Receptor sequence

>4g5qA (length=320) Species: 9606 (Homo sapiens) [Search protein sequence]

AREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQS
IIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRL
WKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY
DLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKK
SPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTK
NVQFVFDAVTDVIIKNNLKD

3D structure

PDB

4g5q Crystal Structures of the scaffolding protein LGN reveal the general mechanism by which GoLoco binding motifs inhibit the release of GDP from Galphai subunits in G-coupled heterotrimeric proteins

Chain

Resolution

2.9 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	E43 T48 R178 D200 Q204
Catalytic site (residue number reindexed from 1)	E13 T18 R148 D170 Q174
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	L39 G40 G42 E43 Q79 Q147 N149 R178 V179 K180 G202 G203 R205 W211 F215 L249 N256	L9 G10 G12 E13 Q49 Q117 N119 R148 V149 K150 G172 G173 R175 W181 F185 L219 N226
BS02	peptide	A	K257 W258	K227 W228
BS03	GDP	A	E43 S44 G45 K46 S47 T48 S151 R176 N269 K270 D272 L273 C325 A326 T327	E13 S14 G15 K16 S17 T18 S121 R146 N239 K240 D242 L243 C295 A296 T297

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0001664	G protein-coupled receptor binding
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0010854	adenylate cyclase regulator activity
GO:0016787	hydrolase activity
GO:0019001	guanyl nucleotide binding
GO:0019003	GDP binding
GO:0031683	G-protein beta/gamma-subunit complex binding
GO:0031749	D2 dopamine receptor binding
GO:0031821	G protein-coupled serotonin receptor binding
GO:0046872	metal ion binding

	Biological Process
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007198	adenylate cyclase-inhibiting serotonin receptor signaling pathway
GO:0034695	response to prostaglandin E
GO:0043434	response to peptide hormone
GO:0043949	regulation of cAMP-mediated signaling
GO:0045542	positive regulation of cholesterol biosynthetic process
GO:0051301	cell division
GO:0060236	regulation of mitotic spindle organization
GO:0072678	T cell migration
GO:1904322	cellular response to forskolin
GO:1904778	positive regulation of protein localization to cell cortex

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005834	heterotrimeric G-protein complex
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0005938	cell cortex
GO:0030496	midbody
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4g5q, PDBe:4g5q, PDBj:4g5q
PDBsum	4g5q
PubMed
UniProt	P63096\|GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-1 (Gene Name=GNAI1)

[Back to BioLiP]