Structure of PDB 4g1c Chain A

Receptor sequence

>4g1cA (length=267) Species: 9606 (Homo sapiens)

PSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDL
ATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRV
VVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALS
GKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEV
DRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRF
RFHFQGPCGTTLPEALA

3D structure

• PDB: 4g1c Synthesis of Carba-NAD and the Structures of Its Ternary Complexes with SIRT3 and SIRT5.
• Chain: A
• Resolution: 1.944 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P68 T69 F70 R71 N141 D143 H158
• Catalytic site (residue number reindexed from 1): P33 T34 F35 R36 N106 D108 H123
• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Y102 R105 I142 H158 V220 V221 F223 G224 E225 N226 L227 V254 Y255 P256	Y67 R70 I107 H123 V185 V186 F188 G189 E190 N191 L192 V219 Y220 P221
BS02	peptide	A	F223 G224	F188 G189
BS03	ZN	A	C166 C169 C207 C212	C131 C134 C172 C177
BS04	CNA	A	A59 G60 P68 T69 F70 Q140 N141 D143 H158 G249 T250 S251 N275 T276 E277 P292 C293	A24 G25 P33 T34 F35 Q105 N106 D108 H123 G214 T215 S216 N240 T241 E242 P257 C258

Gene Ontology

Molecular Function

• GO:0036054 protein-malonyllysine demalonylase activity
• GO:0036055 protein-succinyllysine desuccinylase activity
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:4g1c, PDBe:4g1c, PDBj:4g1c
• PDBsum: 4g1c
• PubMed: 22849721
• UniProt: Q9NXA8|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=SIRT5)