Structure of PDB 4fzv Chain A

Receptor sequence

>4fzvA (length=342) Species: 9606 (Homo sapiens)

FPAVRLALQNFDMTYSVQFGDLWPSIRVSLLSEQKYGALVNNFAAWDHVS
AKLEQLSAKDFVNEAISHWELQSAAPSPASWACSPNLRCFTFDRGDISRF
PPARPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDLCAAPGGKTLALL
QTGCCRNLAANDLSPSRIARLQKILHSYVPEEIRDGNQVRVTSWDGRKWG
ELEGDTYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKERQILPVLQVQLL
AAGLLATKPGGHVVYSTCSLSHLQNEYVVQGAIELLANQYSIQVQVEDLT
HFRRVFMDTFCFFSSCQVGELVIPNLMANFGPMYFCKMRRLT

3D structure

• PDB: 4fzv Structure of the Essential MTERF4:NSUN4 Protein Complex Reveals How an MTERF Protein Collaborates to Facilitate rRNA Modification.
• Chain: A
• Resolution: 1.9996 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAM	A	C181 A182 A183 P185 G186 K187 D204 L205 R209 D237 G238 D255 V256 P257	C139 A140 A141 P142 G144 K145 D162 L163 R167 D195 G196 D213 V214 P215

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008173 RNA methyltransferase activity
• GO:0008649 rRNA methyltransferase activity
• GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
• GO:0009383 rRNA (cytosine-C5-)-methyltransferase activity
• GO:0016428 tRNA (cytidine-5-)-methyltransferase activity
• GO:0019843 rRNA binding

Biological Process

• GO:0001510 RNA methylation
• GO:0006364 rRNA processing
• GO:0031167 rRNA methylation
• GO:0032259 methylation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0005762 mitochondrial large ribosomal subunit

External links

• PDB: RCSB:4fzv, PDBe:4fzv, PDBj:4fzv
• PDBsum: 4fzv
• PubMed: 23022348
• UniProt: Q96CB9|NSUN4_HUMAN 5-methylcytosine rRNA methyltransferase NSUN4 (Gene Name=NSUN4)