Structure of PDB 4fvt Chain A

Receptor sequence

>4fvtA (length=274) Species: 9606 (Homo sapiens)

KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQY
DLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGL
LLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRAD
VMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTS
LEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVE
SLVELLGWTEEMRDLVQRETGKLD

3D structure

• PDB: 4fvt Synthesis of Carba-NAD and the Structures of Its Ternary Complexes with SIRT3 and SIRT5.
• Chain: A
• Resolution: 2.47 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P155 D156 F157 R158 N229 D231 H248
• Catalytic site (residue number reindexed from 1): P34 D35 F36 R37 N108 D110 H127
• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	E177 H248 V292 F293 F294 G295 E296 E325	E56 H127 V171 F172 F173 G174 E175 E204
BS02	CNA	A	G145 A146 G147 T150 P155 D156 F157 N229 I230 D231 H248 T320 S321 V324 N344 R345 V366	G24 A25 G26 T29 P34 D35 F36 N108 I109 D110 H127 T199 S200 V203 N223 R224 V245
BS03	ZN	A	C256 C259 C280 C283	C135 C138 C159 C162

Gene Ontology

Molecular Function

• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:4fvt, PDBe:4fvt, PDBj:4fvt
• PDBsum: 4fvt
• PubMed: 22849721
• UniProt: Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)