Structure of PDB 4fqe Chain A

Receptor sequence
>4fqeA (length=170) Species: 198628 (Dickeya dadantii 3937) [Search protein sequence]
VSIDYRHEMQDGHKDRLLISHRFANGFGLSSEVKWAQVSNGTEVVASYVY
KFNSVFSIEPGFSLESGSSNNNYRPYLRGRANVTDDLSVALRYRPYFKRK
GYTLTGNIDYTFLKDYTIGYELEYKKGTSYDITHNVKLSYKWDKNWKPYV
EVGNVSRQTRYRVGVQYSFH
3D structure
PDB4fqe Structure of the oligogalacturonate-specific KdgM porin.
ChainA
Resolution1.93 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 C8E A G97 L134 Y154 G79 L104 Y124
BS02 C8E A V62 F80 V44 F62
BS03 C8E A I3 Y5 L21 Y214 I3 Y5 L17 Y167
BS04 C8E A S65 P78 G79 F80 P93 Y94 P113 S47 P60 G61 F62 P75 Y76 P95
BS05 C8E A I148 Y150 N194 I118 Y120 N154
Gene Ontology
Molecular Function
GO:0005244 voltage-gated monoatomic ion channel activity
GO:0015288 porin activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0015772 oligosaccharide transport
GO:0034220 monoatomic ion transmembrane transport
GO:0045488 pectin metabolic process
GO:0055085 transmembrane transport
Cellular Component
GO:0009279 cell outer membrane
GO:0046930 pore complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fqe, PDBe:4fqe, PDBj:4fqe
PDBsum4fqe
PubMed24914987
UniProtQ934G3|KDGM_DICD3 Oligogalacturonate-specific porin KdgM (Gene Name=kdgM)

[Back to BioLiP]