Structure of PDB 4fod Chain A

Receptor sequence

>4fodA (length=308) Species: 9606 (Homo sapiens)

TSTIMTDYNPNYSFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQ
VSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSL
PRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYL
EENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRACAMLPVKWMP
PEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGR
MDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTAL
PIEYGPLV

3D structure

• PDB: 4fod The Discovery and Optimization of a Novel Class of Potent, Selective, and Orally Bioavailable Anaplastic Lymphoma Kinase (ALK) Inhibitors with Potential Utility for the Treatment of Cancer.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1249 A1251 R1253 N1254 D1270 R1279
• Catalytic site (residue number reindexed from 1): D159 A161 R163 N164 D180 R189
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	0UV	A	L1122 H1124 A1148 L1196 E1197 M1199 A1200 G1201 G1202 E1210 L1256	L38 H40 A58 L106 E107 M109 A110 G111 G112 E120 L166	MOAD: ic50=0.0012uM PDBbind-CN: -logKd/Ki=8.92,IC50=1.2nM

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:4fod, PDBe:4fod, PDBj:4fod
• PDBsum: 4fod
• PubMed: 22734674
• UniProt: Q9UM73|ALK_HUMAN ALK tyrosine kinase receptor (Gene Name=ALK)