Structure of PDB 4fob Chain A

Receptor sequence

>4fobA (length=295) Species: 9606 (Homo sapiens)

NPNYSFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVA
VKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLEL
MAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIA
ARNCLLTCPGPGRVAKIGDFGMARDIYRAGCAMLPVKWMPPEAFMEGIFT
SKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGP
VYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYG

3D structure

• PDB: 4fob The Discovery and Optimization of a Novel Class of Potent, Selective, and Orally Bioavailable Anaplastic Lymphoma Kinase (ALK) Inhibitors with Potential Utility for the Treatment of Cancer.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1249 A1251 R1253 N1254 D1270 R1279
• Catalytic site (residue number reindexed from 1): D148 A150 R152 N153 D169 R178
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	0US	A	L1122 V1130 A1148 L1196 E1197 M1199 G1201 G1202 L1256 G1269	L30 V38 A50 L98 E99 M101 G103 G104 L155 G168	MOAD: ic50=0.005uM PDBbind-CN: -logKd/Ki=8.30,IC50=5nM BindingDB: IC50=5nM

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:4fob, PDBe:4fob, PDBj:4fob
• PDBsum: 4fob
• PubMed: 22734674
• UniProt: Q9UM73|ALK_HUMAN ALK tyrosine kinase receptor (Gene Name=ALK)