Structure of PDB 4fni Chain A

Receptor sequence

>4fniA (length=110) Species: 158879 (Staphylococcus aureus subsp. aureus N315)

AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDT
DEVKILTIWESEDSFNNYLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVF
KYDIGYHYQK

3D structure

• PDB: 4fni Inactivation of the heme degrading enzyme IsdI by an active site substitution that diminishes heme ruffling.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 1.14.99.48: heme oxygenase (staphylobilin-producing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	N6 R21 F22 R25 Q26 I28 F63 Y66 F72 H76 V79 I92 N95 V97	N8 R23 F24 R27 Q28 I30 F65 Y68 F74 H78 V81 I94 N97 V99

Gene Ontology

Molecular Function

• GO:0004392 heme oxygenase (decyclizing) activity
• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0033212 iron import into cell
• GO:0042167 heme catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4fni, PDBe:4fni, PDBj:4fni
• PDBsum: 4fni
• PubMed: 22891243
• UniProt: Q7A827|HDOX2_STAAN Heme oxygenase (staphylobilin-producing) 2 (Gene Name=isdI)