Structure of PDB 4fi1 Chain A

Receptor sequence
>4fi1A (length=371) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MKCRVWSEARVYTNINKQRTEEYWDYENTVIDWSTNTKDYEIENKVGRGK
YSEVFQGVKLDSKVKIVIKMLKPVKKKKIKREIKILTDLSNEKVPPTTLP
FQKDQYYTNQKEDVLKFIRPYIFDQPHNGHANIIHLFDIIKDPISKTPAL
VFEYVDNVDFRILYPKLTDLEIRFYMFELLKALDYCHSMGIMHRDVKPHN
VMIDHKNKKLRLIDWGLAEFYHVNMEYNVRVASRFFKGPELLVDYRMYDY
SLDLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGTSDFEKYLLKY
EITLPREFYDMDQYIRKPWHRFINDGNKHLSGNDEIIDLIDNLLRYDHQE
RLTAKEAMGHPWFAPIREQIE
3D structure
PDB4fi1 Crystal structure of scCK2 alpha in complex with ATP
ChainA
Resolution2.09 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D195 K197 N200 D214 S233
Catalytic site (residue number reindexed from 1) D195 K197 N200 D214 S233
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A N200 D214 N200 D214
BS02 MG A H187 A354 H187 A354
BS03 ATP A R48 G49 K50 Y51 S52 V54 V67 K69 V155 D195 H199 N200 M202 I213 D214 R48 G49 K50 Y51 S52 V54 V67 K69 V155 D195 H199 N200 M202 I213 D214
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006338 chromatin remodeling
GO:0006356 regulation of transcription by RNA polymerase I
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006468 protein phosphorylation
GO:0006974 DNA damage response
GO:0007535 donor selection
GO:0016310 phosphorylation
GO:0030490 maturation of SSU-rRNA
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0051726 regulation of cell cycle
GO:0060962 regulation of ribosomal protein gene transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0005956 protein kinase CK2 complex
GO:0032040 small-subunit processome
GO:0032545 CURI complex
GO:0034456 UTP-C complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fi1, PDBe:4fi1, PDBj:4fi1
PDBsum4fi1
PubMed
UniProtP15790|CSK21_YEAST Casein kinase II subunit alpha (Gene Name=CKA1)

[Back to BioLiP]