Structure of PDB 4fgh Chain A

Receptor sequence
>4fghA (length=163) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFES
IGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFE
EMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPH
TFLHLIRKKLVPR
3D structure
PDB4fgh Inhibition of Bacterial Dihydrofolate Reductase by 6-Alkyl-2,4-diaminopyrimidines.
ChainA
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) L5 L20 W22 D27 L28 V31 L54 V89 T111
Catalytic site (residue number reindexed from 1) L6 L21 W23 D28 L29 V32 L55 V90 T112
Enzyme Commision number 1.5.1.3: dihydrofolate reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP A V6 A7 I14 N18 Q19 L20 G43 R44 K45 T46 L62 T63 S64 H77 F92 G94 Q95 T96 E100 V7 A8 I15 N19 Q20 L21 G44 R45 K46 T47 L63 T64 S65 H78 F93 G95 Q96 T97 E101
BS02 0U6 A L5 V6 A7 L20 D27 L28 V31 K32 P55 R57 F92 L6 V7 A8 L21 D28 L29 V32 K33 P56 R58 F93 MOAD: Ki=2.9nM
Gene Ontology
Molecular Function
GO:0004146 dihydrofolate reductase activity
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding
Biological Process
GO:0006730 one-carbon metabolic process
GO:0046452 dihydrofolate metabolic process
GO:0046654 tetrahydrofolate biosynthetic process
GO:0046655 folic acid metabolic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fgh, PDBe:4fgh, PDBj:4fgh
PDBsum4fgh
PubMed22930550
UniProtP0A017|DYR_STAAU Dihydrofolate reductase (Gene Name=folA)

[Back to BioLiP]