Structure of PDB 4f75 Chain A

Receptor sequence

>4f75A (length=99) Species: 11685 (HIV-1 M:B_ARV2/SF2)

PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGI
GGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

3D structure

• PDB: 4f75 Crystal Structure of active HIV-1 Protease in Complex with the N terminal product of the substrate RH-IN
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D25 G27 A28 D29 D30 G48 F53	D25 G27 A28 D29 D30 G48 F53
BS02	peptide	A	D25 P81 I84	D25 P81 I84

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:4f75, PDBe:4f75, PDBj:4f75
• PDBsum: 4f75
• UniProt: P03369|POL_HV1A2 Gag-Pol polyprotein (Gene Name=gag-pol)