Structure of PDB 4f4x Chain A

Receptor sequence

>4f4xA (length=342) Species: 273057,330779

MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEA
RKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIE
VASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKI
LAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGI
QKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIV
TMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRG
RTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 4f4x Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
• Chain: A
• Resolution: 2.049 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S103 E106 R241 S298 R299 G300 R301 T302 K340	S103 E106 R241 S298 R299 G300 R301 T302 K340
BS02	dna	A	V32 S34 G41 A42 P60 I62 Q66 A221 K222 R241 V242 R243 K244 S245 G247 R248 I249 T251 L294 R332 R333 R337	V32 S34 G41 A42 P60 I62 Q66 A221 K222 R241 V242 R243 K244 S245 G247 R248 I249 T251 L294 R332 R333 R337
BS03	CA	A	D7 F8 D105	D7 F8 D105
BS04	CA	A	D7 D105 E106	D7 D105 E106
BS05	DCP	A	D9 Y10 F12 A44 T45 Y48 R51 D105 K160	D9 Y10 F12 A44 T45 Y48 R51 D105 K160

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:4f4x, PDBe:4f4x, PDBj:4f4x
• PDBsum: 4f4x
• PubMed: 23245850
• UniProt: Q4JB80|DPO4_SULAC DNA polymerase IV (Gene Name=dbh);
  Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)