Structure of PDB 4f4o Chain A

Receptor sequence
>4f4oA (length=141) Species: 9823 (Sus scrofa) [Search protein sequence]
VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSH
GSDQVKAHGQKVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKL
LSHCLLVTLAAHHPDDFNPSVHASLDKFLANVSTVLTSKYR
3D structure
PDB4f4o Structure of the haptoglobin-haemoglobin complex.
ChainA
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A Y42 F43 H45 H58 K61 L83 L86 H87 L91 V93 N97 F98 L101 L136 Y42 F43 H45 H58 K61 L83 L86 H87 L91 V93 N97 F98 L101 L136
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4f4o, PDBe:4f4o, PDBj:4f4o
PDBsum4f4o
PubMed22922649
UniProtP01965|HBA_PIG Hemoglobin subunit alpha (Gene Name=HBA)

[Back to BioLiP]