Structure of PDB 4f2a Chain A

Receptor sequence

>4f2aA (length=472) Species: 9606 (Homo sapiens) [Search protein sequence]

TSHEAGIVCRITKPALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLGQ
VKYGLHNIQISHLSIASSQVELVEAKSIDVSIQDVSVVFKGTLKYGYTTA
WWLGIDQSIDFEIDSAIDLQINTQLTADSGRVRTDAPDCYLSFHKLLLHL
QGEREPGWIKQLFTNFISFTLKLVLKGQICKEINVISNIMADFVQTRAAS
ILSDGDIGVDISLTGDPVITASYLESHHKGHFIYKDVSEDLPLPTFSPTL
LGDSRMLYFWFSERVFHSLAKVAFQDGRLMLSLMGDEFKAVLETWGFNTN
QEIFQEVVGGFPSQAQVTVHCLKMPKISCQNKGVVVDSSVMVKFLFPRPD
QQHSVAYTFEEDIVTTVQASYSKKKLFLSLLDFQITPKTVSNLTESSSES
IQSFLQSMITAVGIPEVMSRLEVVFTALMNSKGVSLFDIINPEIITRDGF
LLLQMDFGFPEHLLVDFLQSLS

3D structure

PDB

4f2a Crystal structures of cholesteryl ester transfer protein in complex with inhibitors.

Chain

Resolution

3.11 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FUC	A	S401 S402 E403	S397 S398 E399
BS02	2OB	A	I15 L23 V84 S191 V198 L261 F441 F461 F463	I11 L19 V80 S187 V194 L257 F437 F457 F459
BS03	2OB	A	V323 V338 V340 T369 V371 A373 Y375 M412 I413 V416 G417 V421 L425 F429 M433 I448	V319 V334 V336 T365 V367 A369 Y371 M408 I409 V412 G413 V417 L421 F425 M429 I444
BS04	0SF	A	C13 V198 Q199 A202 L206 I215 S230 H232 F263 F441	C9 V194 Q195 A198 L202 I211 S226 H228 F259 F437

Gene Ontology

	Molecular Function
GO:0005548	phospholipid transporter activity
GO:0008289	lipid binding
GO:0015485	cholesterol binding
GO:0017129	triglyceride binding
GO:0031210	phosphatidylcholine binding
GO:0120020	cholesterol transfer activity

	Biological Process
GO:0006641	triglyceride metabolic process
GO:0006869	lipid transport
GO:0008203	cholesterol metabolic process
GO:0010745	negative regulation of macrophage derived foam cell differentiation
GO:0010874	regulation of cholesterol efflux
GO:0015914	phospholipid transport
GO:0030301	cholesterol transport
GO:0032376	positive regulation of cholesterol transport
GO:0034197	triglyceride transport
GO:0034372	very-low-density lipoprotein particle remodeling
GO:0034374	low-density lipoprotein particle remodeling
GO:0034375	high-density lipoprotein particle remodeling
GO:0042632	cholesterol homeostasis
GO:0043691	reverse cholesterol transport
GO:0046470	phosphatidylcholine metabolic process
GO:0055088	lipid homeostasis
GO:0055091	phospholipid homeostasis
GO:0070328	triglyceride homeostasis
GO:2001140	positive regulation of phospholipid transport

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0031982	vesicle
GO:0034364	high-density lipoprotein particle
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4f2a, PDBe:4f2a, PDBj:4f2a
PDBsum	4f2a
PubMed	22961980
UniProt	P11597\|CETP_HUMAN Cholesteryl ester transfer protein (Gene Name=CETP)

[Back to BioLiP]