Structure of PDB 4f02 Chain A

Receptor sequence

>4f02A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence]

MASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNF
QQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKS
IDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMN
GMLLNDRKVFVGRFKSRKEREAELG

3D structure

PDB

4f02 Interdomain Allostery Promotes Assembly of the Poly(A) mRNA Complex with PABP and eIF4G.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	Y14 R41 D45 L52 Y54 Y56 N58 M85 S87 Q88 R89 R94 N100 F102 K104 N105 S127 K138 G139 Y140 F142 H144 F173 K174 S175 R176 R179	Y5 R32 D36 L43 Y45 Y47 N49 M76 S78 Q79 R80 R85 N91 F93 K95 N96 S118 K129 G130 Y131 F133 H135 F164 K165 S166 R167 R170
BS02	peptide	A	A114 T118 G160 M161 L162 L163 N164 D165	A105 T109 G151 M152 L153 L154 N155 D156

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:4f02, PDBe:4f02, PDBj:4f02
PDBsum	4f02
PubMed	23041282
UniProt	P11940\|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]