Structure of PDB 4ew0 Chain A

Receptor sequence
>4ew0A (length=143) Species: 10090 (Mus musculus) [Search protein sequence]
WTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPS
AEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGI
GKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLSLS
3D structure
PDB4ew0 Excision of thymine and 5-hydroxymethyluracil by the MBD4 DNA glycosylase domain: structural basis and implications for active DNA demethylation.
ChainA
Resolution2.39 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.2.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R442 K478 L480 G481 L482 Y483 D484 L485 R31 K67 L69 G70 L71 Y72 D73 L74
BS02 dna A L421 Q423 L440 N441 R442 T443 S444 K446 G510 I511 G512 Y514 N534 K536 L10 Q12 L29 N30 R31 T32 S33 K35 G99 I100 G101 Y103 N123 K125
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ew0, PDBe:4ew0, PDBj:4ew0
PDBsum4ew0
PubMed22740654
UniProtQ9Z2D7|MBD4_MOUSE Methyl-CpG-binding domain protein 4 (Gene Name=Mbd4)

[Back to BioLiP]