Structure of PDB 4ets Chain A

Receptor sequence
>4etsA (length=141) Species: 32022 (Campylobacter jejuni subsp. jejuni) [Search protein sequence]
ENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYTPESLYMEI
KQAEPDLNVGIATVYRTLNLLEEAEMVTSISKKYELANKPHHDHMICKNC
GKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCN
3D structure
PDB4ets Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A D201 E220 H237 D93 E112 H129
BS02 ZN A C205 C208 C245 C248 C97 C100 C137 C140
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900705 negative regulation of siderophore biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ets, PDBe:4ets, PDBj:4ets
PDBsum4ets
PubMed22665794
UniProtP0C631|FUR_CAMJE Ferric uptake regulation protein (Gene Name=fur)

[Back to BioLiP]