Structure of PDB 4er8 Chain A

Receptor sequence
>4er8A (length=165) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MSEYRRYYIKGGTWFFTVNLRNRRSQLLTTQYQMLRHAIIKVKRDRPFEI
NAWVVLPEHMHCIWTLPEGDDDFSSRWREIKKQFTHACGLKNIWQPRFWE
HAIRNTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVARGLYPIDW
AGDVTDFSAGERIIS
3D structure
PDB4er8 The processing of repetitive extragenic palindromes: the structure of a repetitive extragenic palindrome bound to its associated nuclease.
ChainA
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A M1 S2 E3 Y4 R6 Y7 T17 N19 R21 S74 R78 E79 K81 K82 Q83 T85 H86 W94 Q95 R97 F98 W99 E100 H101 A102 G160 E161 R162 M1 S2 E3 Y4 R6 Y7 T17 N19 R21 S74 R78 E79 K81 K82 Q83 T85 H86 W94 Q95 R97 F98 W99 E100 H101 A102 G160 E161 R162
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0000405 bubble DNA binding
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0004803 transposase activity
GO:0032448 DNA hairpin binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006313 DNA transposition
GO:0032196 transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4er8, PDBe:4er8, PDBj:4er8
PDBsum4er8
PubMed22885300
UniProtQ47152|RAYT_ECOLI REP-associated tyrosine transposase (Gene Name=rayT)

[Back to BioLiP]