Structure of PDB 4enm Chain A

Receptor sequence
>4enmA (length=108) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHP
ETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLN
LPEYMWKP
3D structure
PDB4enm Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.
ChainA
Resolution2.8402 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y25 G26 R39 M45 K46 P50 W56 V59 N61 S62 R69 D70 I71 R77 Y25 G26 R39 M45 K46 P50 W56 V59 N61 S62 R69 D70 I71 R77 PDBbind-CN: Kd=0.08nM
BS02 dna A M3 S36 Y37 R39 Q40 Q43 M3 S36 Y37 R39 Q40 Q43 PDBbind-CN: Kd=0.08nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
GO:0032132 O6-alkylguanine-DNA binding
Biological Process
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4enm, PDBe:4enm, PDBj:4enm
PDBsum4enm
PubMed22658721
UniProtQ9UTN9|ATL1_SCHPO Alkyltransferase-like protein 1 (Gene Name=atl1)

[Back to BioLiP]