Structure of PDB 4emt Chain A |
>4emtA (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] |
SVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLP LDCGVPDNLSMADPNIRFLDKLPQDRVYSNSIYELLENGQRAGTCVLEYA TPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLI AYQEPADDSSFSLSQEVLRHLRQEE |
|
PDB | 4emt Structure of STING bound to cyclic di-GMP reveals the mechanism of cyclic dinucleotide recognition by the immune system. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
C2E |
A |
Y163 Y167 R238 T263 P264 |
Y10 Y14 R76 T101 P102 |
Manual survey: Kd=5uM (22728658) MOAD: Kd=4.63uM PDBbind-CN: -logKd/Ki=5.30,Kd~5uM BindingDB: EC50=4500nM,Kd=1210nM |
|
|
|