Structure of PDB 4eid Chain A

Receptor sequence
>4eidA (length=93) Species: 32049 (Picosynechococcus sp. PCC 7002) [Search protein sequence]
ADAAAGAQVFAANCAACHAGGNNAVMPTKTLKADALKTYLAGYKDGSKSL
EEAVAYVVTNGQGAMPAFGGRLSDADIANVAAYIADQAENNKW
3D structure
PDB4eid Atomic-resolution structure of reduced cyanobacterial cytochrome c6 with an unusual sequence insertion.
ChainA
Resolution1.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A N13 C14 C17 H18 N23 V25 M26 K29 T30 L31 L36 Y39 L40 V58 Q62 M65 F68 N13 C14 C17 H18 N23 V25 M26 K29 T30 L31 L36 Y39 L40 V58 Q62 M65 F68
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009579 thylakoid
GO:0031977 thylakoid lumen
GO:0031979 plasma membrane-derived thylakoid lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4eid, PDBe:4eid, PDBj:4eid
PDBsum4eid
PubMed
UniProtO30881|CYC6_PICP2 Cytochrome c6 (Gene Name=petJ)

[Back to BioLiP]