Structure of PDB 4egy Chain A

Receptor sequence
>4egyA (length=81) Species: 1423 (Bacillus subtilis) [Search protein sequence]
LEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQF
GVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
3D structure
PDB4egy Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators.
ChainA
Resolution2.301 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A P3 K4 Y5 S40 H42 T43 Q61 G62 G63 P16 K17 Y18 S53 H55 T56 Q74 G75 G76 PDBbind-CN: Kd=250nM
BS02 dna A T29 E30 R41 R45 Q61 G62 G64 T42 E43 R54 R58 Q74 G75 G77 PDBbind-CN: Kd=250nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4egy, PDBe:4egy, PDBj:4egy
PDBsum4egy
PubMed23109551
UniProtP96711|ARAR_BACSU Arabinose metabolism transcriptional repressor (Gene Name=araR)

[Back to BioLiP]