Structure of PDB 4efs Chain A

Receptor sequence
>4efsA (length=159) Species: 9606 (Homo sapiens) [Search protein sequence]
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINT
GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWT
THSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADD
IRGIQSLYG
3D structure
PDB4efs Simple pseudo-dipeptides with a P2' glutamate: a novel inhibitor family of matrix metalloproteases and other metzincins.
ChainA
Resolution1.63 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H218 E219 H222 H228
Catalytic site (residue number reindexed from 1) H114 E115 H118 H124
Enzyme Commision number 3.4.24.65: macrophage elastase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN A H218 H222 H228 H114 H118 H124
BS02 ZN A H168 D170 H183 H196 H64 D66 H79 H92
BS03 CA A D158 G190 G192 D194 D54 G86 G88 D90
BS04 CA A D124 E199 E201 D20 E95 E97
BS05 CA A D175 G176 G178 I180 D198 E201 D71 G72 G74 I76 D94 E97
BS06 E37 A I180 L181 A182 L214 H218 E219 H222 H228 P232 A234 V235 P238 T239 Y240 K241 I76 L77 A78 L110 H114 E115 H118 H124 P128 A130 V131 P134 T135 Y136 K137 MOAD: Ki=2.5nM
PDBbind-CN: -logKd/Ki=8.60,Ki=2.5nM
BindingDB: Ki=2.5nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4efs, PDBe:4efs, PDBj:4efs
PDBsum4efs
PubMed22689580
UniProtP39900|MMP12_HUMAN Macrophage metalloelastase (Gene Name=MMP12)

[Back to BioLiP]