Structure of PDB 4efh Chain A

Receptor sequence

>4efhA (length=364) Species: 5755 (Acanthamoeba castellanii)

VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL
NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVT
HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR
DIKEKLCYVALDFEQEMHTAASSSALEKSYELPDGQVITIGNERFRAPEA
LFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIA
DRMQKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKE
EYDESGPSIVHRKC

3D structure

• PDB: 4efh Multiple Forms of Spire-Actin Complexes and their Functional Consequences.
• Chain: A
• Resolution: 2.48 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	G23 D24 D25 R28 Y143 G146 T148 E167 G168 S348 L349 T351	G19 D20 D21 R24 Y133 G136 T138 E157 G158 S338 L339 T341
BS02	CA	A	P264 S265	P254 S255
BS03	ADP	A	G13 S14 G15 K18 G156 D157 G182 R210 K213 E214 G302 T303 M305 F306 K336	G9 S10 G11 K14 G146 D147 G172 R200 K203 E204 G292 T293 M295 F296 K326

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0006909 phagocytosis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0015629 actin cytoskeleton

External links

• PDB: RCSB:4efh, PDBe:4efh, PDBj:4efh
• PDBsum: 4efh
• PubMed: 22334675
• UniProt: P02578|ACT1_ACACA Actin-1