Structure of PDB 4ef4 Chain A |
>4ef4A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] |
NFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYIL LPLDCGVPDNLSMADPNIRFLDKLPQQRVYSNSIYELLENGQRAGTCVLE YATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCR LIAYQEPFSLSQEVLRHLRQEEKEEVTV |
|
PDB | 4ef4 Structural analysis of the STING adaptor protein reveals a hydrophobic dimer interface and mode of cyclic di-GMP binding |
Chain | A |
Resolution | 2.147 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
C2E |
A |
Y167 T263 P264 |
Y16 T103 P104 |
Manual survey: Kd=4.42uM (22579474) MOAD: Kd=4.42uM PDBbind-CN: -logKd/Ki=5.35,Kd=4.42uM BindingDB: EC50=4500nM,Kd=1210nM |
BS02 |
CA |
A |
D205 E316 |
D54 E156 |
Manual survey: Kd=4.42uM (22579474) |
|
|
|